Logo
Information on 1f6w_A_215
Loop code: 1f6w_A_215
PDB: 1f6w
Chain: A
Type: EH beta-alpha
Loop Start: 215  Loop Length: 13
Sec Struct Nt length: 5  Sec Struct Ct length: 12
Structure geometry
d (Å): 26.381599 delta (°): 77.235703theta (°): 64.396004 rho (°): 17.269600
Sequence:RAISQSGVALSPWVIQKNPLFWAKKVAEKV
Sec Struct:EEEEES--TTSTTTS-S-HHHHHHHHHHHH