Logo
Information on 1bi8_A_105
Loop code: 1bi8_A_105
PDB: 1bi8
Chain: A
Type: HH alpha-alpha
Loop Start: 105   Loop Length: 9
Sec Struct Nt length: 5   Sec Struct Ct length: 19
Structure geometry
d (Å): 14.2712 delta (°): 77.9331 theta (°): 99.9999 rho (°): 99.9999
Sequence: LTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLH
Sec Struct: HHHHHTTS-TT-S-HHHHHHHHHHHHHHHHHHH