|
|
|
|
|
|
|
| Information on 1mz8_B_515 |
|
Loop code: 1mz8_B_515 PDB: 1mz8 Chain: B Type: HE alpha-beta |
Loop Start: 515 Loop Length: 19 Sec Struct Nt length: 8 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | RNNNDRMKVGKAPKTRTQDVSGKRTSFELHH |
| Sec Struct: | HHHHHHHHTT---B--GGG-BTTB-B-EEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PO4PHOSPHATE ION | L - 543 | 1 | 0 |
| ZNZINC ION | L - 543 | 1 | 0 |
| PO4PHOSPHATE ION | H - 544 | 1 | 0 |
| ZNZINC ION | H - 544 | 1 | 0 |
| PO4PHOSPHATE ION | H - 545 | 1 | 0 |
| ZNZINC ION | H - 545 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|