Logo
Information on 1k3a_A_1057
Loop code: 1k3a_A_1057
PDB: 1k3a
Chain: A
Type: HH alpha-alpha
Loop Start: 1057   Loop Length: 8
Sec Struct Nt length: 6   Sec Struct Ct length: 20
Structure geometry
d (Å): 16.1263 delta (°): 67.3499 theta (°): 87.1494 rho (°): 99.9999
Sequence: LKSYLRSLRPEMPSLSKMIQMAGEIADGMAYLNA
Sec Struct: HHHHHHTT-S----HHHHHHHHHHHHHHHHHHHH