Logo
Information on 1msw_D_176
Loop code: 1msw_D_176
PDB: 1msw
Chain: D
Type: HH alpha-alpha
Loop Start: 176  Loop Length: 18
Sec Struct Nt length: 14  Sec Struct Ct length: 16
Structure geometry
d (Å): 26.288700 delta (°): 122.949097theta (°): 122.378700 rho (°): 6.481800
Sequence:HVYKKAFMQVVEADMLSKGLLGGEAWSSWHKEDSIHVGVRCIEMLIES
Sec Struct:HHHHHHHHHHHHHHSTTTTTTTT-------TTHHHHHHHHHHHHHHHH