Logo
Information on 1qhi_A_255
Loop code: 1qhi_A_255
PDB: 1qhi
Chain: A
Type: HH alpha-alpha
Loop Start: 255   Loop Length: 31
Sec Struct Nt length: 4   Sec Struct Ct length: 15
Structure geometry
d (Å): 16.3647 delta (°): 99.9999 theta (°): 99.9999 rho (°): 99.9999
Sequence: WREDWGQLSPRPHIGDTLFTLFRAPELLAPNGDLYNVFAWALDVLAKRLR
Sec Struct: HHHHGGGG-----GGGSGGGGG--GGGB-TTS-B-HHHHHHHHHHHHHHH