|
|
|
|
|
|
|
| Information on 1aro_P_111 |
|
Loop code: 1aro_P_111 PDB: 1aro Chain: P Type: HH alpha-alpha |
Loop Start: 111 Loop Length: 8 Sec Struct Nt length: 15 Sec Struct Ct length: 27 Structure geometry
|
| Sequence: | PEAVAYITIKTTLACLTSADNTTVQAVASAIGRAIEDEARFGRIRDLEAK |
| Sec Struct: | HHHHHHHHHHHHHHHTT-SS--BHHHHHHHHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| HGMERCURY (II) ION | T - 121 | 1 | 0 |
| HGMERCURY (II) ION | A - 124 | 0 | 1 |
| HGMERCURY (II) ION | C - 125 | 0 | 1 |
| HGMERCURY (II) ION | N - 131 | 0 | 1 |
| HGMERCURY (II) ION | A - 136 | 1 | 0 |
| HGMERCURY (II) ION | V - 137 | 1 | 0 |
| HGMERCURY (II) ION | A - 140 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|