Logo
Information on 1i7d_A_309
Loop code: 1i7d_A_309
PDB: 1i7d
Chain: A
Type: HH alpha-alpha
Loop Start: 309  Loop Length: 22
Sec Struct Nt length: 13  Sec Struct Ct length: 11
Structure geometry
d (Å): 19.135201 delta (°): 66.918701theta (°): 112.074600 rho (°): 329.489410
Sequence:AQNVLDICQKLYETHKLITFPRSDCRYLPEEHFAGRHAVMNAISVH
Sec Struct:HHHHHHHHHHHHHTS--BS-SS-----B-GGGGGGHHHHHHHHHHH