|
|
|
|
|
|
|
| Information on 1qsa_A_523 |
|
Loop code: 1qsa_A_523 PDB: 1qsa Chain: A Type: HH alpha-alpha |
Loop Start: 523 Loop Length: 4 Sec Struct Nt length: 18 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | PETNINIGTSYLQYVYQQFGNNRIFSSAAYNA |
| Sec Struct: | HHHHHHHHHHHHHHHHHHTTS-HHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | Y - 533 | 1 | 0 |
| GOLGLYCEROL | R - 545 | 0 | 1 |
| GOLGLYCEROL | A - 551 | 1 | 0 |
| GOLGLYCEROL | Y - 552 | 1 | 0 |
| GOLGLYCEROL | N - 553 | 1 | 0 |
| Associated ArchDB40 Subclass to 1qsa_A_523 |
| Associated ArchDB95 Subclass to 1qsa_A_523 |
| Associated ArchDB-EC Subclass to 1qsa_A_523 |
| For any comment or web-related incidence, send an email to the webmaster. |
|