|
|
|
|
|
|
|
| Information on 1pix_A_547 |
|
Loop code: 1pix_A_547 PDB: 1pix Chain: A Type: HH alpha-alpha |
Loop Start: 547 Loop Length: 14 Sec Struct Nt length: 12 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | IRGYVEAFTEAAYQNPESICPFHQMILPRAIREFET |
| Sec Struct: | HHHHHHHHHHHHTTS-S----GGG-SHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| FMTFORMIC ACID | R - 548 | 1 | 0 |
| FMTFORMIC ACID | E - 552 | 1 | 0 |
| FMTFORMIC ACID | P - 574 | 1 | 0 |
| FMTFORMIC ACID | I - 577 | 1 | 0 |
| FMTFORMIC ACID | R - 578 | 1 | 0 |
| FMTFORMIC ACID | E - 581 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|