|
|
|
|
|
|
|
| Information on 1mty_D_213 |
|
Loop code: 1mty_D_213 PDB: 1mty Chain: D Type: HH alpha-alpha |
Loop Start: 213 Loop Length: 4 Sec Struct Nt length: 14 Sec Struct Ct length: 27 Structure geometry
|
| Sequence: | TNPLIVAVTEWAAANGDEITPTVFLSIETDELRHMANGYQTVVSI |
| Sec Struct: | HHHHHHHHHHHHHHTT--HHHHHHHHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| FEFE (III) ION | T - 213 | 1 | 0 |
| FEFE (III) ION | I - 239 | 1 | 0 |
| FEFE (III) ION | D - 242 | 1 | 0 |
| FEFE (III) ION | E - 243 | 1 | 0 |
| FEFE (III) ION | H - 246 | 1 | 0 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| FE1FE BINDING SITE. | E - 243 | 1 | 0 |
| Associated ArchDB95 Subclass to 1mty_D_213 |
| For any comment or web-related incidence, send an email to the webmaster. |
|