Logo
Information on 1bbu_A_169
Loop code: 1bbu_A_169
PDB: 1bbu
Chain: A
Type: HH alpha-alpha
Loop Start: 169  Loop Length: 1
Sec Struct Nt length: 7  Sec Struct Ct length: 22
Structure geometry
d (Å): 6.651600 delta (°): 79.402298theta (°): 115.411903 rho (°): 142.206497
Sequence:RYLDLISNDESRNTFKVRSQILSGIRQFMV
Sec Struct:HHHHHHH-HHHHHHHHHHHHHHHHHHHHHH