|
|
|
|
|
|
|
| Information on 1bif_*_344 |
|
Loop code: 1bif_*_344 PDB: 1bif Chain: * Type: HH alpha-alpha |
Loop Start: 344 Loop Length: 12 Sec Struct Nt length: 9 Sec Struct Ct length: 17 Structure geometry
|
| Sequence: | PLEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELER |
| Sec Struct: | HHHHHHHHH-TTT---TT---HHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PO4PHOSPHATE ION | R - 350 | 1 | 0 |
| PO4PHOSPHATE ION | K - 354 | 0 | 1 |
| PO4PHOSPHATE ION | Y - 359 | 0 | 1 |
| PO4PHOSPHATE ION | Y - 365 | 0 | 1 |
| GOLGLYCEROL | P - 374 | 1 | 0 |
| GOLGLYCEROL | V - 375 | 1 | 0 |
| GOLGLYCEROL | E - 378 | 1 | 0 |
| GOLGLYCEROL | L - 379 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|