Logo
Information on 1igw_B_4
Loop code: 1igw_B_4
PDB: 1igw
Chain: B
Type: HH alpha-alpha
Loop Start: 4  Loop Length: 14
Sec Struct Nt length: 11  Sec Struct Ct length: 6
Structure geometry
d (Å): 9.950300 delta (°): 127.498299theta (°): 137.704498 rho (°): 7.790900
Sequence:RTQQIEELQKEWTQPRWEGITRPYSAEDVVK
Sec Struct:HHHHHHHHHHHTTSGGGTT---SS-HHHHHH