|
|
|
|
|
|
|
| Information on 1l6j_A_395 |
|
Loop code: 1l6j_A_395 PDB: 1l6j Chain: A Type: HH alpha-alpha |
Loop Start: 395 Loop Length: 26 Sec Struct Nt length: 12 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | LFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHL |
| Sec Struct: | HHHHHHHHHHHHTT------TTSTT-SB----SS----HHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ZNZINC ION | H - 401 | 1 | 0 |
| ZNZINC ION | E - 402 | 1 | 0 |
| ZNZINC ION | H - 405 | 0 | 1 |
| ZNZINC ION | H - 411 | 0 | 1 |
| ZNZINC ION | M - 419 | 0 | 1 |
| ZNZINC ION | Y - 420 | 0 | 1 |
| ZNZINC ION | P - 421 | 0 | 1 |
| Associated ArchDB-EC Subclass to 1l6j_A_395 |
| For any comment or web-related incidence, send an email to the webmaster. |
|