Logo
Information on 1nsa_*_82
Loop code: 1nsa_*_82
PDB: 1nsa
Chain: *
Type: HH alpha-alpha
Loop Start: 82  Loop Length: 19
Sec Struct Nt length: 6  Sec Struct Ct length: 14
Structure geometry
d (Å): 18.903200 delta (°): 54.470901theta (°): 39.383099 rho (°): 27.813400
Sequence:LRSVLEAQFDSVSRTTGHSYEKYNNWETIEAWTEQVTSK
Sec Struct:HHHHHHTS-------SS--TTS---HHHHHHHHHHHHHH