Logo
Information on 1noy_A_309
Loop code: 1noy_A_309
PDB: 1noy
Chain: A
Type: HH alpha-alpha
Loop Start: 309  Loop Length: 1
Sec Struct Nt length: 27  Sec Struct Ct length: 12
Structure geometry
d (Å): 9.018400 delta (°): 94.618500theta (°): 59.665100 rho (°): 87.469704
Sequence:LRETNHQRYISYNIIDVESVQAIDKIRGFIDLVLSMSYYA
Sec Struct:HHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHH