Logo
Information on 1d2f_A_271
Loop code: 1d2f_A_271
PDB: 1d2f
Chain: A
Type: HH alpha-alpha
Loop Start: 271  Loop Length: 1
Sec Struct Nt length: 13  Sec Struct Ct length: 25
Structure geometry
d (Å): 5.413500 delta (°): 73.873901theta (°): 78.401802 rho (°): 117.744102
Sequence:VLALTAHIAAYQQGAPWLDALRIYLKDNLTYIADKMNAA
Sec Struct:HHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHH