Logo
Information on 1gox_*_165
Loop code: 1gox_*_165
PDB: 1gox
Chain: *
Type: HH alpha-alpha
Loop Start: 165  Loop Length: 20
Sec Struct Nt length: 5  Sec Struct Ct length: 7
Structure geometry
d (Å): 17.984600 delta (°): 84.184097theta (°): 132.837997 rho (°): 187.333694
Sequence:EADIKNRFVLPPFLTLKNFEGIDLGLSSYVAG
Sec Struct:HHHHHTT----TT---GGGSSS---HHHHHHH