|
|
|
|
|
|
|
| Information on 1noy_B_287 |
|
Loop code: 1noy_B_287 PDB: 1noy Chain: B Type: HH alpha-alpha |
Loop Start: 287 Loop Length: 20 Sec Struct Nt length: 9 Sec Struct Ct length: 20 Structure geometry
|
| Sequence: | LESVAQHETKKGKLPYDGPINKLRETNHQRYISYNIIDVESVQAIDKIR |
| Sec Struct: | HHHHHHHHH--------S-SGGGGGGGTTHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ZNZINC ION | E - 288 | 1 | 0 |
| ZNZINC ION | K - 299 | 0 | 1 |
| ZNZINC ION | Y - 320 | 1 | 0 |
| ZNZINC ION | N - 321 | 1 | 0 |
| MNMANGANESE (II) ION | D - 324 | 1 | 0 |
| ZNZINC ION | D - 324 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|