Logo
Information on 1g71_A_182
Loop code: 1g71_A_182
PDB: 1g71
Chain: A
Type: HH alpha-alpha
Loop Start: 182  Loop Length: 10
Sec Struct Nt length: 10  Sec Struct Ct length: 13
Structure geometry
d (Å): 16.242901 delta (°): 108.629097theta (°): 118.961998 rho (°): 189.509903
Sequence:VEEFRRFLLEKRGWFVLKHGYPRVFRLRLGYFI
Sec Struct:HHHHHHHHHH-GGGGG-SSSHHHHHHHHHHHHH