Logo
Information on 1a76_*_258
Loop code: 1a76_*_258
PDB: 1a76
Chain: *
Type: HH alpha-alpha
Loop Start: 258  Loop Length: 16
Sec Struct Nt length: 9  Sec Struct Ct length: 8
Structure geometry
d (Å): 40.714401 delta (°): 43.535198theta (°): 145.843796 rho (°): 125.712097
Sequence:YDEIKRIFKEPKVTDNYSLSLKLPDKEGIIKFL
Sec Struct:HHHHHHHHHS---------------HHHHHHHH