Logo
Information on 1dc1_A_21
Loop code: 1dc1_A_21
PDB: 1dc1
Chain: A
Type: HH alpha-alpha
Loop Start: 21  Loop Length: 15
Sec Struct Nt length: 33  Sec Struct Ct length: 7
Structure geometry
d (Å): 11.864500 delta (°): 106.811600theta (°): 117.140800 rho (°): 204.970398
Sequence:YEEYRAGFIAFALEKNKRSTPYIERARALKVAASVAKTPKDLLYLEDIQDALLYA
Sec Struct:HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT-SSGGGGGG-GGGHHHHHHH
PDB ligands within a cut-off distance of 6 Å in this loop
LigandsResidueatSSatLOOP
DIO1,4-DIETHYLENE DIOXIDE Y - 2110
DIO1,4-DIETHYLENE DIOXIDE R - 2510
DIO1,4-DIETHYLENE DIOXIDE F - 2810
DIO1,4-DIETHYLENE DIOXIDE I - 2910
DIO1,4-DIETHYLENE DIOXIDE A - 3210
DIO1,4-DIETHYLENE DIOXIDE L - 3310
DIO1,4-DIETHYLENE DIOXIDE N - 3610