Logo
Information on 1ctt_*_157
Loop code: 1ctt_*_157
PDB: 1ctt
Chain: *
Type: HH alpha-alpha
Loop Start: 157  Loop Length: 29
Sec Struct Nt length: 4  Sec Struct Ct length: 11
Structure geometry
d (Å): 43.205002 delta (°): 122.098503theta (°): 78.565697 rho (°): 247.025604
Sequence:LRDYLPDAFGPKDLEIKTLLMDEQDHGYALTGDALSQAAIAAAN
Sec Struct:HHHHSTT---GGGGT----BTS---------SSHHHHHHHHHHH