Logo
Information on 1sat_*_56
Loop code: 1sat_*_56
PDB: 1sat
Chain: *
Type: EH beta-alpha
Loop Start: 56  Loop Length: 21
Sec Struct Nt length: 6  Sec Struct Ct length: 17
Structure geometry
d (Å): 12.219500 delta (°): 35.651199theta (°): 159.968201 rho (°): 44.148399
Sequence:VKLTFSFPDYKFSSTNVAGDTGLSKFSAEQQQQAKLSLQSWADV
Sec Struct:EEEEEE-----TT---TTS-BS-B---HHHHHHHHHHHHHHHHH