Logo
Information on 1yfo_A_214
Loop code: 1yfo_A_214
PDB: 1yfo
Chain: A
Type: HH alpha-alpha
Loop Start: 214  Loop Length: 10
Sec Struct Nt length: 25  Sec Struct Ct length: 4
Structure geometry
d (Å): 26.811501 delta (°): 33.354000theta (°): 115.157700 rho (°): 108.204903
Sequence:VDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAAS
Sec Struct:HHHHHHHHHHHHHHHHHHHHHHHHHS-S-SS----HHHH