|
|
|
|
|
|
|
| Information on 1lln_A_93 |
|
Loop code: 1lln_A_93 PDB: 1lln Chain: A Type: HH alpha-alpha |
Loop Start: 93 Loop Length: 18 Sec Struct Nt length: 5 Sec Struct Ct length: 8 Structure geometry
|
| Sequence: | AQETVCPGDKSKPGTQNNIPYESYKGMESKG |
| Sec Struct: | HHHHHTTT------TTTB-S---HHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MLYN-DIMETHYL-LYSINE | I - 111 | 0 | 1 |
| MLYN-DIMETHYL-LYSINE | P - 112 | 0 | 1 |
| MLYN-DIMETHYL-LYSINE | Y - 113 | 0 | 1 |
| MLYN-DIMETHYL-LYSINE | E - 114 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|