|
|
|
|
|
|
|
| Information on 1k3x_A_168 |
|
Loop code: 1k3x_A_168 PDB: 1k3x Chain: A Type: HH alpha-alpha |
Loop Start: 168 Loop Length: 12 Sec Struct Nt length: 11 Sec Struct Ct length: 21 Structure geometry
|
| Sequence: | NYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYAT |
| Sec Struct: | HHHHHHHHHHHT--SS--GGGS-HHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PEDPENTANE-3,4-DIOL-5-PHOSPHATE | N - 168 | 1 | 0 |
| PEDPENTANE-3,4-DIOL-5-PHOSPHATE | Y - 169 | 1 | 0 |
| ZNZINC ION | W - 176 | 1 | 0 |
| GOLGLYCEROL | D - 195 | 1 | 0 |
| GOLGLYCEROL | A - 196 | 1 | 0 |
| GOLGLYCEROL | H - 199 | 1 | 0 |
| GOLGLYCEROL | E - 203 | 1 | 0 |
| Associated ArchDB40 Subclass to 1k3x_A_168 |
| Associated ArchDB95 Subclass to 1k3x_A_168 |
| For any comment or web-related incidence, send an email to the webmaster. |
|