Logo
Information on 1i4n_A_4
Loop code: 1i4n_A_4
PDB: 1i4n
Chain: A
Type: HH alpha-alpha
Loop Start: 4  Loop Length: 16
Sec Struct Nt length: 11  Sec Struct Ct length: 6
Structure geometry
d (Å): 28.479401 delta (°): 91.445198theta (°): 150.311996 rho (°): 81.564796
Sequence:LWEIVEAKKKDILEIDGENLIVQRRNHRFLEVL
Sec Struct:HHHHHHHHHHHGGG--GGG--------HHHHHH