Logo
Information on 1fx2_A_958
Loop code: 1fx2_A_958
PDB: 1fx2
Chain: A
Type: HH alpha-alpha
Loop Start: 958  Loop Length: 6
Sec Struct Nt length: 17  Sec Struct Ct length: 16
Structure geometry
d (Å): 22.082001 delta (°): 86.590202theta (°): 38.422901 rho (°): 181.186295
Sequence:PFAAVQLAQELQLCFLHHDWGTNALDDSYREFEEQRAEG
Sec Struct:HHHHHHHHHHHHHHHHHS--S-SHHHHHHHHHHHHHHHH
PDB ligands within a cut-off distance of 6 Å in this loop
LigandsResidueatSSatLOOP
DTT2,3-DIHYDROXY-1,4-DITHIOBUTANE L - 96810
DTT2,3-DIHYDROXY-1,4-DITHIOBUTANE Q - 96910
DTT2,3-DIHYDROXY-1,4-DITHIOBUTANE L - 97010
DTT2,3-DIHYDROXY-1,4-DITHIOBUTANE F - 97210
DTT2,3-DIHYDROXY-1,4-DITHIOBUTANE L - 97301
DTT2,3-DIHYDROXY-1,4-DITHIOBUTANE W - 97701
DTT2,3-DIHYDROXY-1,4-DITHIOBUTANE D - 98310