|
|
|
|
|
|
|
| Information on 1lml_*_238 |
|
Loop code: 1lml_*_238 PDB: 1lml Chain: * Type: EH beta-alpha |
Loop Start: 238 Loop Length: 11 Sec Struct Nt length: 7 Sec Struct Ct length: 14 Structure geometry
|
| Sequence: | PAVGVINIPAANIASRYDQLVTRVVTHEMAHA |
| Sec Struct: | EEEEEEE--GGG---S--HHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ZNZINC ION | H - 264 | 1 | 0 |
| ZNZINC ION | E - 265 | 1 | 0 |
| ZNZINC ION | H - 268 | 1 | 0 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| ACT - ACTIVE SITE. | H - 264 | 1 | 0 |
| ACT - ACTIVE SITE. | E - 265 | 1 | 0 |
| ACT - ACTIVE SITE. | H - 268 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|