Logo
Information on 1mh2_A_2
Loop code: 1mh2_A_2
PDB: 1mh2
Chain: A
Type: HH alpha-alpha
Loop Start: 2  Loop Length: 26
Sec Struct Nt length: 11  Sec Struct Ct length: 15
Structure geometry
d (Å): 17.290001 delta (°): 92.153999theta (°): 151.049805 rho (°): 332.063293
Sequence:TYQFQNMIQCTVPKRSWRDFADYGCYCGRGGSGTPIDDLDSCCQVHDNCYNS
Sec Struct:HHHHHHHHHHH-TTS-GGGGSSBTTTBSS---S---SHHHHHHHHHHHHHHH