Logo
Information on 1h5u_A_601
Loop code: 1h5u_A_601
PDB: 1h5u
Chain: A
Type: EH beta-alpha
Loop Start: 601  Loop Length: 7
Sec Struct Nt length: 6  Sec Struct Ct length: 17
Structure geometry
d (Å): 15.583100 delta (°): 50.910000theta (°): 154.502106 rho (°): 206.854202
Sequence:RTVMIGGKAAPGYHMAKMIIKLITAIGDVV
Sec Struct:EEEEEE----TT-HHHHHHHHHHHHHHHHH