Logo
Information on 1ogm_X_358
Loop code: 1ogm_X_358
PDB: 1ogm
Chain: X
Type: HA beta-beta hairpin
Loop Start: 358  Loop Length: 16
Sec Struct Nt length: 11  Sec Struct Ct length: 9
Structure geometry
d (Å): 14.604000 delta (°): 153.364304theta (°): 65.090302 rho (°): 223.614395
Sequence:ISSQISDYKQVGAFFFQTDGPEIYPNSVVHDVFWHV
Sec Struct:EEEEEEEEEEE---STT----B--TT-EEEEEEEEE
PDB Site Annotation
SiteResidueatSSatLOOP
CAT - CATALYTIC RESIDUES D - 37601