|
|
|
|
|
|
|
| Information on 1a0c_A_291 |
|
Loop code: 1a0c_A_291 PDB: 1a0c Chain: A Type: EH beta-alpha |
Loop Start: 291 Loop Length: 18 Sec Struct Nt length: 5 Sec Struct Ct length: 13 Structure geometry
|
| Sequence: | LGSIDANTGDMLLGWDTDQFPTDIRMTTLAMYEVIK |
| Sec Struct: | EEEEE--B--TTS-S---B----HHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| COCOBALT (II) ION | D - 295 | 0 | 1 |
| COCOBALT (II) ION | N - 297 | 0 | 1 |
| COCOBALT (II) ION | D - 306 | 0 | 1 |
| COCOBALT (II) ION | T - 307 | 0 | 1 |
| COCOBALT (II) ION | D - 308 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| CO1CO BINDING SITE 1 OF MOLECULE A | D - 295 | 0 | 1 |
| CO2CO BINDING SITE 2 OF MOLECULE A | D - 306 | 0 | 1 |
| CO2CO BINDING SITE 2 OF MOLECULE A | D - 308 | 0 | 1 |
| Associated ArchDB-EC Subclass to 1a0c_A_291 |
| For any comment or web-related incidence, send an email to the webmaster. |
|