|
|
|
|
|
|
|
| Information on 1lgp_A_72 |
|
Loop code: 1lgp_A_72 PDB: 1lgp Chain: A Type: AR beta-beta link |
Loop Start: 72 Loop Length: 25 Sec Struct Nt length: 5 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | VTLEDTSTSGTVINKLKVVKKQTCPLQTGDVIYLV |
| Sec Struct: | EEEEE-SSS-----------SS-----TT-EEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| WO4TUNGSTATE(VI)ION | S - 78 | 0 | 1 |
| WO4TUNGSTATE(VI)ION | T - 79 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|