|
|
|
|
|
|
|
| Information on 1k0e_A_418 |
|
Loop code: 1k0e_A_418 PDB: 1k0e Chain: A Type: EH beta-alpha |
Loop Start: 418 Loop Length: 5 Sec Struct Nt length: 10 Sec Struct Ct length: 19 Structure geometry
|
| Sequence: | QIFCSAGGGIVADSQEEAEYQETFDKVNRILKQL |
| Sec Struct: | EEEEEEEEEE-TT--HHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| FMTFORMIC ACID | S - 422 | 1 | 0 |
| FMTFORMIC ACID | A - 423 | 1 | 0 |
| FMTFORMIC ACID | G - 424 | 1 | 0 |
| FMTFORMIC ACID | G - 425 | 1 | 0 |
| FMTFORMIC ACID | T - 440 | 1 | 0 |
| FMTFORMIC ACID | K - 443 | 1 | 0 |
| FMTFORMIC ACID | V - 444 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|