Logo
Information on 1uyp_A_398
Loop code: 1uyp_A_398
PDB: 1uyp
Chain: A
Type: AR beta-beta link
Loop Start: 398  Loop Length: 8
Sec Struct Nt length: 6  Sec Struct Ct length: 16
Structure geometry
d (Å): 18.262600 delta (°): 96.601402theta (°): 147.516800 rho (°): 357.289093
Sequence:IAFSFRIHPENVYNILSVKSNQVKLEVFEL
Sec Struct:EEEEEE---SS---EEEEEEEEEEEEEEEE