|
|
|
|
|
|
|
| Information on 1bif_*_429 |
|
Loop code: 1bif_*_429 PDB: 1bif Chain: * Type: EH beta-alpha |
Loop Start: 429 Loop Length: 21 Sec Struct Nt length: 7 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | CKVESIFLNVAAVNTHRDRPQNVDISRPSEEA |
| Sec Struct: | EEEEEEE-S-----------S---TT--HHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PO4PHOSPHATE ION | T - 443 | 0 | 1 |
| PO4PHOSPHATE ION | R - 445 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|