Information on 1gvz_A_104 |
Loop code: 1gvz_A_104 PDB: 1gvz Chain: A Type: AR beta-beta link |
Loop Start: 104 Loop Length: 24 Sec Struct Nt length: 5 Sec Struct Ct length: 8 Structure geometry
|
Sequence: | MLLRLAQPARITDAVKILDLPTQEPKLGSTCYTSGWG |
Sec Struct: | EEEEESS----BTTB------SS---TT-EEEEEEEE |
PDB ligands within a cut-off distance of 6 Å in this loop |
Ligands | Residue | atSS | atLOOP |
GOLGLYCEROL | L - 121 | 0 | 1 |
ACTACETATE ION | L - 123 | 0 | 1 |
Associated ArchDB95 Subclass to 1gvz_A_104 |