|
|
|
|
|
|
|
| Information on 1nx4_A_174 |
|
Loop code: 1nx4_A_174 PDB: 1nx4 Chain: A Type: AR beta-beta link |
Loop Start: 174 Loop Length: 25 Sec Struct Nt length: 2 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | FKVPVFTDLGWVRKLIYFPFDEGQPASWEPRI |
| Sec Struct: | EE--S--B-SS-B---B----TTS--SEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | P - 177 | 0 | 1 |
| MSESELENOMETHIONINE | V - 178 | 0 | 1 |
| MSESELENOMETHIONINE | F - 179 | 0 | 1 |
| MSESELENOMETHIONINE | T - 180 | 0 | 1 |
| MSESELENOMETHIONINE | W - 184 | 0 | 1 |
| MSESELENOMETHIONINE | R - 186 | 0 | 1 |
| MSESELENOMETHIONINE | K - 187 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|