|
|
|
|
|
|
|
| Information on 2cst_A_33 |
|
Loop code: 2cst_A_33 PDB: 2cst Chain: A Type: EH beta-alpha |
Loop Start: 33 Loop Length: 16 Sec Struct Nt length: 2 Sec Struct Ct length: 12 Structure geometry
|
| Sequence: | VNLGVGAYRTDEGQPWVLPVVRKVEQLIAG |
| Sec Struct: | EE--SS----TTS-----HHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MAEMALEIC ACID | G - 36 | 0 | 1 |
| MAEMALEIC ACID | V - 37 | 0 | 1 |
| MAEMALEIC ACID | G - 38 | 0 | 1 |
| PLPPYRIDOXAL-5'-PHOSPHATE | G - 38 | 0 | 1 |
| MAEMALEIC ACID | A - 39 | 0 | 1 |
| Associated ArchDB95 Subclass to 2cst_A_33 |
| Associated ArchDB-EC Subclass to 2cst_A_33 |
| For any comment or web-related incidence, send an email to the webmaster. |
|