|
|
|
|
|
|
|
| Information on 1qs0_A_300 |
|
Loop code: 1qs0_A_300 PDB: 1qs0 Chain: A Type: EH beta-alpha |
Loop Start: 300 Loop Length: 20 Sec Struct Nt length: 6 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | SLIEWVTYRAGPHSTSDDPSKYRPADDWSH |
| Sec Struct: | EEEEEE----S-SSTT--GGGTS-TTHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MGMAGNESIUM ION | R - 308 | 0 | 1 |
| TDPTHIAMIN DIPHOSPHATE | R - 308 | 0 | 1 |
| MSESELENOMETHIONINE | H - 312 | 0 | 1 |
| TDPTHIAMIN DIPHOSPHATE | H - 312 | 0 | 1 |
| MSESELENOMETHIONINE | S - 313 | 0 | 1 |
| MSESELENOMETHIONINE | T - 314 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|