Logo
Information on 1pn0_A_556
Loop code: 1pn0_A_556
PDB: 1pn0
Chain: A
Type: HA beta-beta hairpin
Loop Start: 556  Loop Length: 25
Sec Struct Nt length: 7  Sec Struct Ct length: 3
Structure geometry
d (Å): 8.631100 delta (°): 135.174805theta (°): 25.243299 rho (°): 205.615601
Sequence:IDVITIHSCHRDDIEMHDFPAPALHPKWQYDFIYA
Sec Struct:EEEEEEESS-TTS--GGGS-TTTTS-TT--SSEEE