Logo
Information on 1fp3_A_368
Loop code: 1fp3_A_368
PDB: 1fp3
Chain: A
Type: EH beta-alpha
Loop Start: 368  Loop Length: 11
Sec Struct Nt length: 3  Sec Struct Ct length: 20
Structure geometry
d (Å): 16.843901 delta (°): 89.795998theta (°): 129.489304 rho (°): 99.139999
Sequence:VALTIKGGPFKGCFHVPRCLAMCEEMLSALLSRL
Sec Struct:EEE--SS-SS--SSHHHHHHHHHHHHHHHHHHHH