Logo
Information on 1qup_A_79
Loop code: 1qup_A_79
PDB: 1qup
Chain: A
Type: HA beta-beta hairpin
Loop Start: 79  Loop Length: 14
Sec Struct Nt length: 7  Sec Struct Ct length: 9
Structure geometry
d (Å): 6.761100 delta (°): 126.616203theta (°): 126.122200 rho (°): 297.135895
Sequence:SAVAILETFQKYTIDQKKDTAVRGLARIVQ
Sec Struct:EEEEEEE--S--SS----S--EEEEEEEEE