|
|
|
|
|
|
|
| Information on 1rxx_A_208 |
|
Loop code: 1rxx_A_208 PDB: 1rxx Chain: A Type: AR beta-beta link |
Loop Start: 208 Loop Length: 22 Sec Struct Nt length: 4 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | EIWYGDPDKDHGSSTLEGGDVPIGNGVVLI |
| Sec Struct: | EEEE--TTS--TT----GGG---BTTEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | S - 221 | 0 | 1 |
| MSESELENOMETHIONINE | T - 222 | 0 | 1 |
| MSESELENOMETHIONINE | L - 223 | 0 | 1 |
| MSESELENOMETHIONINE | E - 224 | 0 | 1 |
| MSESELENOMETHIONINE | G - 225 | 0 | 1 |
| MSESELENOMETHIONINE | G - 226 | 0 | 1 |
| MSESELENOMETHIONINE | D - 227 | 0 | 1 |
| MSESELENOMETHIONINE | V - 228 | 0 | 1 |
| MSESELENOMETHIONINE | V - 235 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|