Logo
Information on 1a0t_P_304
Loop code: 1a0t_P_304
PDB: 1a0t
Chain: P
Type: HA beta-beta hairpin
Loop Start: 304  Loop Length: 18
Sec Struct Nt length: 13  Sec Struct Ct length: 12
Structure geometry
d (Å): 6.367200 delta (°): 120.624702theta (°): 162.176102 rho (°): 322.654388
Sequence:DGSSKTALLYGHGLGAEVKGIGSDGALRPGADTWRIASYGTTP
Sec Struct:EEEEEEEEEEEEETT-S-SBTT--TT--TT-EEEEEEEEEEEE