Logo
Information on 1pj5_A_452
Loop code: 1pj5_A_452
PDB: 1pj5
Chain: A
Type: EH beta-alpha
Loop Start: 452  Loop Length: 20
Sec Struct Nt length: 7  Sec Struct Ct length: 4
Structure geometry
d (Å): 23.607800 delta (°): 116.822403theta (°): 84.509399 rho (°): 296.453400
Sequence:WERPYWFEANAALLKEMPAEWLPPARDAWSG
Sec Struct:EEEEEEEGGGGGGGGGS-GGG------HHHH