|
|
|
|
|
|
|
| Information on 1itu_A_283 |
|
Loop code: 1itu_A_283 PDB: 1itu Chain: A Type: EH beta-alpha |
Loop Start: 283 Loop Length: 19 Sec Struct Nt length: 3 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | VGFGGDFDGVPRVPEGLEDVSKYPDLIAELLR |
| Sec Struct: | EEE---TTS-S---BT-SSTT-HHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CILCILASTATIN | D - 288 | 0 | 1 |
| ZNZINC ION | D - 288 | 0 | 1 |
| CILCILASTATIN | D - 290 | 0 | 1 |
| CILCILASTATIN | G - 291 | 0 | 1 |
| ZNZINC ION | G - 291 | 0 | 1 |
| CILCILASTATIN | V - 292 | 0 | 1 |
| CILCILASTATIN | P - 293 | 0 | 1 |
| CILCILASTATIN | R - 294 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|